PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.H04082.1.p
Common NameEUGRSUZ_H04082
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 402aa    MW: 44862.9 Da    PI: 9.7076
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.H04082.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.92.3e-18653148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT eEd+ lv++++ +G g+W++ ar  g++Rt+k+c++rw++yl
  Eucgr.H04082.1.p  6 RGPWTVEEDLTLVNYIANHGEGRWNSLARSAGLKRTGKSCRLRWLNYL 53
                      89********************************************97 PP

2Myb_DNA-binding491.4e-1559102146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg+ T eE++ +++++ ++G++ W++Ia++++ gRt++++k++w++
  Eucgr.H04082.1.p  59 RGNITLEEQLMILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 102
                       7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.701157IPR017930Myb domain
SuperFamilySSF466892.3E-304100IPR009057Homeodomain-like
SMARTSM007171.3E-14555IPR001005SANT/Myb domain
PfamPF002491.3E-16653IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-22760IPR009057Homeodomain-like
CDDcd001672.06E-11853No hitNo description
PROSITE profilePS5129418.16858108IPR017930Myb domain
SMARTSM007172.6E-1458106IPR001005SANT/Myb domain
PfamPF002492.7E-1459102IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.8E-2361107IPR009057Homeodomain-like
CDDcd001673.31E-1163102No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009620Biological Processresponse to fungus
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MEDLRRGPWT VEEDLTLVNY IANHGEGRWN SLARSAGLKR TGKSCRLRWL NYLRPDVRRG  60
NITLEEQLMI LELHSRWGNR WSKIAQHLPG RTDNEIKNYW RTRVQKHAKQ LKCDVNSKQF  120
KDAMKYLWMP RLVERIQAAS ASVSTATVAA AAMAAPPTMA TTAASNIGGM AFPPALAGMG  180
GDFRGGRVNV APSYSTPENS CTTASSDSFG AQVSPVSDLT DLTEYYPIPA GDNPNPDYYQ  240
PNNNGQGCYQ ESSLTSPCAY FNNYGMDFQA CMDQNNNQCI FHYPRSISFS FHLDLIVSIV  300
GDHGLEANQE RKMRGLFNAS ERGCALLAPP SFYLQKGCRA GGKKLGEERE AKSKAIILIA  360
KLFDKKRMSM GPERRRKKSH VSRFAPRQGF ERQCDWGRGV A*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-2611062106B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00334DAPTransfer from AT3G06490Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.H04082.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010024826.10.0PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE13e-86MY108_ARATH; Transcription factor MYB108
TrEMBLA0A059B5M00.0A0A059B5M0_EUCGR; Uncharacterized protein
STRINGPOPTR_0010s15970.11e-124(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.15e-84myb domain protein 112